SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CBS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CBS8
Domain Number 1 Region: 335-698
Classification Level Classification E-value
Superfamily SIS domain 6.4e-103
Family double-SIS domain 0.000000404
Further Details:      
 
Domain Number 2 Region: 2-211,266-310
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.05e-50
Family Class II glutamine amidotransferases 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CBS8
Sequence length 698
Comment (tr|F7CBS8|F7CBS8_MONDO) Glutamine--fructose-6-phosphate transaminase 1 {ECO:0000313|Ensembl:ENSMODP00000014778} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=GFPT1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLIK
KKGKVKALDEEVNKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVI
HNGIITNYKDLRKFLESKGYDFESETDTESIAKLVKYMYDNRESDDISFTTLVERVIQQL
EGAFALVFKSVHYPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTARVQIGSTLTQWG
SQGERGKDKKGSCSLSRVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAA
VVDGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGR
VNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASD
FLDRNTPVFRDDVCFFISQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVH
INAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIVLGLKGLPDLIKEVLSM
DDEIQKLAIELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALV
DKLMPVIMIIMRDNTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDC
LQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences F7CBS8
ENSMODP00000014778 13616.ENSMODP00000014778 ENSMODP00000014778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]