SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CE61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CE61
Domain Number 1 Region: 312-413
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-26
Family Zf-UBP 0.0044
Further Details:      
 
Domain Number 2 Region: 295-340
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000757
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Weak hits

Sequence:  F7CE61
Domain Number - Region: 205-260
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.015
Family Canonical RBD 0.061
Further Details:      
 
Domain Number - Region: 468-578
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0732
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CE61
Sequence length 608
Comment (tr|F7CE61|F7CE61_MONDO) BRCA1 associated protein {ECO:0000313|Ensembl:ENSMODP00000015282} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=BRAP OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SPGKGPPRRPRPSRVLSPPEPVGARARAAPARPMSVSLVVIRLELADHSPLPAGFGFSAA
AGEEMSDEEIKEKTLASAKAHLEGKAPVEKAAIIHQHLGRREMTDMIIETIKSNPDEMKA
TMEERKSSEASSSPEKSRNADHSKEIAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKT
NKMTSLKEDVRRSAMLCVLTVPASTGYDLMKFVAPFKEVIEHMKIIRDSTPNQYMVLIKF
SAQADADSFYMACNGRQFNSIEEDVCQLVYVERAEVVKSEDGASLPVMDLTELPKCTVCL
ERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWI
CLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQ
YECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKET
IEKCDTLEHRLNDLLKEKQSVERKCTQLNVKLAKLSTELKEEQEMNKCLRANQVLLQNKL
KEEEKVLKETCDQKDMQITEIQEQLRDVMFYLEAQQKINHLPAETRQEIQEGQINIAMAS
AASSPSVG
Download sequence
Identical sequences F7CE61
ENSMODP00000015282 ENSMODP00000015282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]