SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CGD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CGD4
Domain Number 1 Region: 416-687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-78
Family Protein kinases, catalytic subunit 0.0000000404
Further Details:      
 
Domain Number 2 Region: 863-1005
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 137-255
Classification Level Classification E-value
Superfamily Second domain of FERM 7.98e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 37-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-31
Family First domain of FERM 0.00049
Further Details:      
 
Domain Number 5 Region: 260-365
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-31
Family Third domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CGD4
Sequence length 1008
Comment (tr|F7CGD4|F7CGD4_HORSE) Protein tyrosine kinase 2 beta {ECO:0000313|Ensembl:ENSECAP00000017277} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PTK2B OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPADVEKEDVRILKVCFYSNSFNPKNFKLVKC
TVHTEIREVIASILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECL
HMEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCL
ELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASL
REEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLAE
FKQIKSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKGS
LIIHPKKDGEKRNSLPQIPVLNLETQRSRLSESCSIESDIYAEIPDETLRRPGGPQYGIA
REDVVLSRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNL
DHPHIVKLIGIIEEEPTWIIMELYPFGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLE
SINCVHRDIAVRNILVASANCVKLGDFGLSRYIEDEEYYKASVTRLPIKWMAPESINFRR
FTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLMTRC
WDYDPSERPRFTELVCSLSDVYQMEKDIDTEQERNARYRPPKILEPTALQEPPPKPSRPK
YRTPPQTNLLAPTLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMRE
GDFVRPSSREEAQQLWEAERVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPL
TPEKEPGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQL
PPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQ
QNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences F7CGD4
9796.ENSECAP00000017277 ENSECAP00000017277 ENSECAP00000017277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]