SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CGS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CGS0
Domain Number 1 Region: 21-342
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.31e-85
Family Glycosyl hydrolases family 35 catalytic domain 0.0000962
Further Details:      
 
Domain Number 2 Region: 462-598
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.12e-28
Family Beta-galactosidase LacA, domains 4 and 5 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CGS0
Sequence length 609
Comment (tr|F7CGS0|F7CGS0_HORSE) Beta-galactosidase {ECO:0000256|RuleBase:RU000675} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
RVNQTFLTPYHMRNRHVGLKVEGSNFTLDGFPFLIISGTIHYFRVPRDYWRDRLLKLKAC
GFNTVTTHVPWNLHEPKRSQFYFIGNLDLKAFLFVASEVGLWVILCPGPYIGSDLDLGGL
PSWLLQDPKMKLRTTYKGFTKAVNRYFDMLVPRIAPLQYKNGGPIIAVQVENEYGSYHLD
KRYMLYIKKALVKRGVDVLLMTADDGEGLIRGHLEKVIATVHMKNIKKETYEKLSSIQGR
SPILMMVYTANSLDGWGTLRHTLDENVLMKDVREMFNLRFSLNFYMFHGGTNFGFMGGAA
SLQNYLPTVTSYGNCYYGALLTEDGDYTPEYISFQELFSSVIEIPKLSREDARPKAVYKS
VTTAYYMSLWDILTYLDEPVRSAKPICMEKLSVNQGSGQSYGYILYETVITTGGLLASRG
HVQDRGQVFLEEKYIGILDHSTNQLTIPKEKGQKDYLTLRILVENQGRLAYGQDINKERK
GLTGDIYLNNSPLRNFKIYSLEMNPKFLKRGLPKIWKPVIHKLQGPAFFLGILRVGNYPK
DTFIKLEDWTKGVIFINGQNLGRYWNIGPQETFYLPGPWLQPGSNEIIVFEEFKSGTKIQ
FTNMSHLGT
Download sequence
Identical sequences F7CGS0
ENSECAP00000017266 ENSECAP00000017266 9796.ENSECAP00000017266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]