SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CIW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CIW5
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 1.54e-44
Family ML domain 0.00000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CIW5
Sequence length 149
Comment (tr|F7CIW5|F7CIW5_HORSE) NPC intracellular cholesterol transporter 2 {ECO:0000313|Ensembl:ENSECAP00000015851} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NPC2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRSLDAAFLLLALGASALANPVHFKDCGSQVGVVKEVNVNPCSTQPCQLHKGQSYSVNVT
FTSNTQSQSSKAVVHGIVLGVPVPFPIPEPDGCKSGISCPIQKDKSYNYVNKLPVKSEYP
SIKLVVKWELQDDKGQSLFCWEIPVQIEG
Download sequence
Identical sequences F7CIW5
9796.ENSECAP00000015851 ENSECAP00000015851 XP_001490688.1.31192 XP_005605383.1.31192 XP_005605384.1.31192 ENSECAP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]