SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CJR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CJR8
Domain Number 1 Region: 229-328
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 427-534
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000581
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 3 Region: 529-628
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000769
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 656-820
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000136
Family Fibronectin type III 0.0051
Further Details:      
 
Weak hits

Sequence:  F7CJR8
Domain Number - Region: 328-411
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0959
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CJR8
Sequence length 894
Comment (tr|F7CJR8|F7CJR8_MONDO) Leptin receptor {ECO:0000313|Ensembl:ENSMODP00000001394} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LEPR OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MFFLKFLVASLQWDFIRMIIADDTAYQIPPWNFTLSCFLPNKTDEFHWPSGAPKTSSVSD
EDHQSTDTSFNLHDSHPSTESFYCCLWSEHDKNPSMCANSTERKTFVSPTAHSLAWTQRG
SVSWSIQCWVKMDLKILICDLESSFKNSAETLKFQAHLSYVLSEASQEDSPMVSQKGDFQ
VVQCNCSRSEDCECQVPMPIAKLSSTSLMYLEITNGVLFLQSPLMSVKLINIVKPDPPLR
LLMEITDDGKLKISWSSPPLTPYQLQYEVKYSVKSTETRAQIAEIVLDTFLLVGNVLPGS
SYTAQVRGKRLDGPGAWSDWSTPSNFTTPEVIYFPPKILTSVGSNASFYCIYKHRNTIVP
SKNVFWWLNLAEKIPPSHYDVMNAHVSRVTLLNMNATKPRGKYAYDAVYCCQENECHHRY
AELYVIDVNINISCETDGYLTKMTCRWPANTVASLAGSMLQLRYFRSSLYCSDFPTTHHA
SDPKDCHLQMDGFYECTFQPIFLLSGYTMWIHISHSLGSLESPPTCVVPDSVVKPLPPSR
VNAEVMAKTGLLNVSWRKPDLPENKLQFQIRYAVNDHGELWKLHQAYGSESTSASFQVLD
FCSVYIAQVRCKRLDGLGYWSNWSNPAYTVVMDIKAPTRGPEFWGIVHEDPMGKERNITL
FWKPLGKNHSLCSVRRYIVKHYTESNKTWAEDTGNATKVTFPWTELAHTVTVVAVNSIGP
SIVNFNLTFSWHMSTVNSVQSLSVHAVNSSCVVLSWIIEPTEYTLMYFVIEWKNLDEENG
IKWIRVSSNVKKYYIRDHFIPIEKYQFSLYPVFLEGVGKPVMTNTIPREDTMKQENDPGL
YVIIPIVISSSVLLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGVNFHKRVDVL
Download sequence
Identical sequences F7CJR8
ENSMODP00000001394 ENSMODP00000001394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]