SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CJW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CJW0
Domain Number 1 Region: 234-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 518-630
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-16
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  F7CJW0
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0403
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CJW0
Sequence length 736
Comment (tr|F7CJW0|F7CJW0_MONDO) KRIT1, ankyrin repeat containing {ECO:0000313|Ensembl:ENSMODP00000013369} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=KRIT1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
SGEITQSILDYVVETTKPISPANQGIKGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYSYSPGCPVFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATEPSQTENLLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SELLNRLLNDSFSVNQLDNDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHVEIVQILLNHPEVDRHIIDQQGRSPLNVCEENKQNDWEETAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSHETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILNELTNLDPQRETPQLFLRRDVRLPLEVERKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQVFTKASSSSHKVIRVYV
GVNIKGLHLLNMETKTLLISLKYGCFMWQLGDADSCFQIHSLENKMSFIVHTKQAGLVVK
LLLKLNGQLMPSERNE
Download sequence
Identical sequences F7CJW0
ENSMODP00000013369 ENSMODP00000013369 13616.ENSMODP00000013369 XP_001378239.1.35504 XP_007505068.1.35504 XP_007505069.1.35504 XP_016281892.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]