SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CK41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CK41
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-67
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CK41
Sequence length 226
Comment (tr|F7CK41|F7CK41_XENTR) Spectrin, beta, non-erythrocytic 1 {ECO:0000313|Ensembl:ENSXETP00000063066} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sptbn1 OC=Silurana.
Sequence
PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQ
DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLI
DFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKM
KALAVEGKRIGKVLDNAIETEKMIERYPQYFFCAKCAWKCLWHPKR
Download sequence
Identical sequences F7CK41
ENSXETP00000063066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]