SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CMZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CMZ2
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.87e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CMZ2
Sequence length 346
Comment (tr|F7CMZ2|F7CMZ2_CALJA) KH RNA binding domain containing, signal transduction associated 3 {ECO:0000313|Ensembl:ENSCJAP00000007850} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KHDRBS3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
SVSTLLPSISPTSSLLIPTLKHQARLINREIEKFQKGEGKDEEKYIDVVINKNMKLGQKV
LIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKY
FHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSEN
ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRG
LLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYENSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
Download sequence
Identical sequences F7CMZ2
ENSCJAP00000007850 ENSCJAP00000007855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]