SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CNF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CNF3
Domain Number 1 Region: 52-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000615
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CNF3
Sequence length 217
Comment (tr|F7CNF3|F7CNF3_XENTR) Phosphotyrosine interaction domain-containing 1 {ECO:0000313|Ensembl:ENSXETP00000032333} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=pid1 OC=Silurana.
Sequence
QRQRAQDRTQHFQTMIKSKLNVLTLHKEPLPAVIFHEPEDIELCTTMPLMKTRPHAGCKV
TYLGKVSTTGGQFASGCTEQPVIELWKQHTLAREDVFPSNALLEIRPFQVRLHHQDLKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSFQMDCHAVECESKLEAKKLAH
AMMVAFKKTFQSMRSDGRIHQDSSSEEVSQGFESDDG
Download sequence
Identical sequences F7CNF3
ENSXETP00000032333 ENSXETP00000032333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]