SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CPW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CPW6
Domain Number 1 Region: 29-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000402
Family Ovomucoid domain III-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CPW6
Sequence length 85
Comment (tr|F7CPW6|F7CPW6_MACMU) Serine peptidase inhibitor, Kazal type 7 (putative) {ECO:0000313|Ensembl:ENSMMUP00000022224} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_17000 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKIIGGLLLLCTVFYFCSSSEAASLSSKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGSC
Download sequence
Identical sequences F7CPW6 G7P8M3
XP_005558253.1.63531 ENSMMUP00000022224 ENSMMUP00000022224 9544.ENSMMUP00000022224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]