SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CTK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CTK7
Domain Number 1 Region: 191-374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-30
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-22
Family Laminin G-like module 0.00077
Further Details:      
 
Domain Number 3 Region: 132-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000259
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  F7CTK7
Domain Number - Region: 170-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0461
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7CTK7
Sequence length 395
Comment (tr|F7CTK7|F7CTK7_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000003978} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
DFLCISLVNGSVQLRYNLGDRTIILETLQKVNMNGSTWHVIKAGRVGAEGYLDLDGKTVT
EKAKAEMNSLDTNTDFYIGGVSSLNLVNPMAIANEPVGFQGCIREVIINNQELQLTELGA
KGGSNVGDCDGTACGYNVCRNRGECVVNGTTFSCQCSPPWAGNTCEQSAYCLNNLCLHQS
LCVPDQSSSYRCLCTLGWEGRYCENKISFSTAKFMGNSYIKYIDPDYRMRNHHFTTVSLN
FSTTETEGLIVWIGKAQNEENDFLAIGLHNQSLKIAVNLGESISVPVIYSNGTFCCNKWH
HVIVSQNQTLIKAYLDDNLILSEDIDPHKKFVALNYDGISYLGGFEYGRKVNTVTEEIFK
RDFVGKIKDVFFQDSKKIELIKSEGYNVYNGDEQN
Download sequence
Identical sequences F7CTK7
9796.ENSECAP00000003978 ENSECAP00000003978 ENSECAP00000003978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]