SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CUR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CUR9
Domain Number 1 Region: 306-490,603-822,852-882
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-102
Family Ras GEF 0.00047
Further Details:      
 
Domain Number 2 Region: 55-185
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-30
Family DEP domain 0.0000358
Further Details:      
 
Domain Number 3 Region: 511-612
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-27
Family Ras-binding domain, RBD 0.0072
Further Details:      
 
Domain Number 4 Region: 179-308
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-26
Family cAMP-binding domain 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7CUR9
Sequence length 882
Comment (tr|F7CUR9|F7CUR9_CALJA) Rap guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSCJAP00000027568} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RAPGEF3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVLRRMHRPRSCSYQLLLEHRRPSHIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGK
QLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQAVGICQVLLDE
GVLCHVKHDWAFQDRDAQFYRFPGPEPEPMEAHEMEEELAEAVALLSQRGPDALLTVALR
KPPGQRTDEELDLIFEELLHVKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTS
WYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDF
NRIIKDVEAKTMRLEEHGKVVLVLERASQGVGSSRPPTPGRNRRYTVMSGTPEKILELLL
EAMGPDSSAHDPTETFLSDFLLTHRVFMPSAHLCAALLHHFHAEPAGGSEQERSTYVCNK
RQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVSGDARLSNLLREQWPERRRHHRLE
NGCGNASPQMKARNLPIWLPNQDEPLPGSSCAIRVGDKVPYDICRPDHSVLTLQLPVTAS
VKEVMAALAQEDGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEMHEL
TPHPEQLGPTVGSAEGLDLVSAKDLAGQLTDQDWSLFNSVHQVELIHYVLGPQHLRDVTT
ANLERFMRRFNQLQYWVATELCLCVAPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGL
SNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKD
MTFIHEGNHTLVENLINFEKMRMMARASRMLHHCRSHNPVPLSPLRSRVSHLHEDSQVAR
ISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences F7CUR9
ENSCJAP00000027568 ENSCJAP00000027568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]