SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CV04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CV04
Domain Number 1 Region: 810-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family Laminin-type module 0.0000536
Further Details:      
 
Domain Number 2 Region: 706-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 268-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 866-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 5 Region: 917-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 429-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 380-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 324-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 755-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 10 Region: 965-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000165
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  F7CV04
Domain Number - Region: 1058-1279
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000305
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 
Domain Number - Region: 1261-1508
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 82-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00446
Family Galactose-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CV04
Sequence length 1591
Comment (tr|F7CV04|F7CV04_HORSE) Laminin subunit gamma 1 {ECO:0000313|Ensembl:ENSECAP00000021019} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LAMC1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
RAPVLSIYTVQRPSASRAAMDECTDEGGRSQCMPEFVNAAYNVTVVATNTCGTPPEEYCV
QTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLYGVQYPNSINLTLH
LGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGG
DEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNT
FGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVDCEK
CLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTDGAN
CERCRENFFRRGNSEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLT
EAGCRPCSCNPSGSVDECNFETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCF
GHSSVCTNAVGYSVYSITSTFQIDEDGWHAEQRDGSEASLEWSSERQDIAVISDSYFPRY
FIAPAKFLGTQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSE
TTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARP
GPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDPETG
VCNCRDNTAGPHCEKCSDGYYGDSTVGGTSDCQPCPCPGGSSCAVVPKTQEVVCTNCPTG
TTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYNTAG
FYCDRCKEGFFGNPLAPNPADKCKACDCNPYGTVRQQSGCNPVTGQCECLPHVTGRDCGA
CDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCELCEVNHFGFGHE
GCKPCDCHPEGSLSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPGCQECPACYRLV
KDKVADHRVKLQELENLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQN
LMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKAKIA
VANVSITQPDSTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANETSTEAYNLLLRT
LAGENQTAFEIEELNRKYEQAKNISEDLEKQASRVHEEAKRAGDKAVEIYASVAQLTPVD
SEALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKELEVKNLLEKGKTEQQTADQL
LARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEEALRRIPAINQTI
AEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLD
NEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSATSLLNLIN
DLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRD
IEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences F7CV04
ENSECAP00000021019 9796.ENSECAP00000021019 ENSECAP00000021019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]