SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CVM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CVM1
Domain Number 1 Region: 160-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 2 Region: 221-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-16
Family Complement control module/SCR domain 0.00016
Further Details:      
 
Domain Number 3 Region: 281-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000764
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 4 Region: 34-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 5 Region: 95-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7CVM1
Sequence length 544
Comment (tr|F7CVM1|F7CVM1_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000002786} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSPASHRAPPTLGHPGLLSLLLLLLYLSKAHGECNIPPDIPNAKPELNGVTSFPVDTTVT
YKCNEGFVKMPGKSDSLVCLQTNKWSKLSEFCNRTCDVPPLLRFASLKKQFSKQNYFPVG
SVVQYECRPGYKRDPSLPAKLTCLQNVVWSNASEFCKRKSCPTPPELLHGHVDIATDILL
GSVITYTCNEGYRLLGAEDSHCIFMDKNVVWSPPPPECTEILCQEPPKIVNGEIQGNQDS
YKYGSSVTYTCDKNLSLIGEKSIHCTVKDEQGEWSSPPPQCKDVRCENPIVPNGQKKSPS
KPPYRYQDTLIFDCNPGFILVGNSTIQCGSDNKWTPGIPLCKGITTVAPTTVKKLTTTNA
PATEAPPTQQVNPTNAPTTKEQSLTEQANATSSPTTEVPPTMQQANPTNAPQTKSPPPIQ
QVNVTNVATTPTPTTSKRSTTTTQSSTKIVTTLRPFKTTSFHTTRRVTEMSAKRTTPSGA
ATSFSGIVGGLIVMAVLIVLPVFVKLLYNYGKSGSYNIHEISKELYVVLSDKMETGKPTE
EIHI
Download sequence
Identical sequences F7CVM1
ENSMODP00000002786 ENSMODP00000002786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]