SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CZ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7CZ87
Domain Number - Region: 299-323
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0123
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CZ87
Sequence length 622
Comment (tr|F7CZ87|F7CZ87_MONDO) Zinc finger CCCH-type containing 12A {ECO:0000313|Ensembl:ENSMODP00000022187} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZC3H12A OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLSYRCGTKGRSQGCGTVGLWGRSGSPHNRTGMVAPELGQPEVVDDTELQMKVDFFRKLG
YSSGEIHGVLHKLGLQADTNTVLGELVKHGPATDRETPLDGPPEPPLVPRGGGTPKVPSS
CSLPTEDKEVSNLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHSDITVFVPLW
RKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGIIVS
NDTYRDLQCERLEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLVLEHK
KQPCPYGKKCTYGIKCRFYHPERPSRPQRSVADELRANARLSPPRAPAKDQKCRQPSPTS
TPAPGSLPVKNDRECWLPEKFLGPQQASGGNGDGQTKAYAQGRSLPTVSGGFGPADWGPP
PLDSLSYLSQDCLDSGIGSLESQMSDLWGGRGSSHGESGEPSRTGGSGSNPQRCTFLGRG
PLLTYGPEPPAGPSSVSFSGYGRPVGTGQFSIPAEYPPPLGYAPREYWSEPYPMPPPTAT
RAPPALQDPHLLSAPAAYGAEAAAWGAGTDSFTKERASLRVKLCGIFPPHLVEAVMSRFP
QLLDPLQLAAEILNYKSQNPSG
Download sequence
Identical sequences F7CZ87
ENSMODP00000022187 13616.ENSMODP00000022187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]