SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CZ99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7CZ99
Domain Number - Region: 332-356
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0128
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CZ99
Sequence length 642
Comment (tr|F7CZ99|F7CZ99_MONDO) Zinc finger CCCH-type containing 12A {ECO:0000313|Ensembl:ENSMODP00000022186} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZC3H12A OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNMDSRGLMALTPQSEGPAKQANPAMNLSTTQENAALGPTSLTPHPRGRGSPQTSRSGSP
HNRTGMVAPELGQPEVVDDTELQMKVDFFRKLGYSSGEIHGVLHKLGLQADTNTVLGELV
KHGPATDRETPLDGPPEPPLVPRGGGTPKVPSSCSLPTEDKEVSNLRPVVIDGSNVAMSH
GNKEVFSCRGILLAVNWFLERGHSDITVFVPLWRKEQPRPDVPITDQHILRELEKKKILV
FTPSRRVGGKRVVCYDDRFIVKLAFESDGIIVSNDTYRDLQCERLEWKRFIEERLLMYSF
VNDKFMPPDDPLGRHGPSLDNFLRKKPLVLEHKKQPCPYGKKCTYGIKCRFYHPERPSRP
QRSVADELRANARLSPPRAPAKDQKCRQPSPTSTPAPGSLPVKNDRECWLPEKFLGPQQA
SGGNGDGQTKAYAQGRSLPTVSGGFGPADWGPPPLDSLSYLSQDCLDSGIGSLESQMSDL
WGGRGSSHGESGEPSRTGGSPLLTYGPEPPAGPSSVSFSGYGRPVGTGQFSIPAEYPPPL
GYAPREYWSEPYPMPPPTATRAPPALQDPHLLSAPAAYGAEAAAWGAGTDSFTKERASLR
VKLCGIFPPHLVEAVMSRFPQLLDPLQLAAEILNYKSQNPSG
Download sequence
Identical sequences F7CZ99
ENSMODP00000022187 ENSMODP00000022186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]