SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CZN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CZN8
Domain Number 1 Region: 81-318
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-56
Family DBL homology domain (DH-domain) 0.0000411
Further Details:      
 
Domain Number 2 Region: 316-442
Classification Level Classification E-value
Superfamily PH domain-like 2e-34
Family Pleckstrin-homology domain (PH domain) 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CZN8
Sequence length 1025
Comment (tr|F7CZN8|F7CZN8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000018921} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100027283 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTISTRGRLQSAMNTPGTLNRFGSGTGEMDESDSGFLKFKQTTDDSLSLASSTTESIFVE
DSYSASLRSEIEADAQEFEAESWSLSVEPAYAKKQKREVLKRQDVIYELMQTEVHHVRTL
KIMLKVYSRALKEEMQFSSRVLNRIFPCVDDLLEMHGQFLYRLKERRRESLAEGSDQNYV
IQKIGDLLVQQFSGENGERMKEKYGIFCSGHNEAVSHYKELLSQNKKFQNMIKKIGNFSI
VRRLGVQECILLVTQRITKYPVLEERIIQNTEAGTEDYEDLNQALGLIKDIITQVDAKVN
ECEKGQRLKEIVGKMDLKSSGKLKNGLTFRKEDMLHRQLHLDGMLCWKTASGRLKDVLAV
LLTDVLLLLQEKDQKYVFASVDSKPPVISLQKLIVREVANEEKAMFLISASLKGPEMYEI
YTCSKDERNSWMAQIRRAVESCPDGEEEPFSEAEEDRKMAEARAVKLKEFQERLSRKDEL
IAQSLIEKQQIYLEMSEMNSFEDLPPGPRPRFFFRGGEPSENLQGEMILKSAVSEIENIQ
NLIYKQLGTVSCRNEDGGSGGGDDLLLPRRAETFGGYDNNANTNKNASFKKKVSNSDTWF
KDRRNPFTSSDSQLGDLSGDSEEGSQILSFQTEGTRVDWNNSLSSILESELIQRIQMLSQ
LLLNLQAVVAQQDSYIEMQRAMILEKEKQYRLQSTRGNFLLEQEKQRNFEKQREELANVQ
KLQNQLKQEQQRWERERERQQKELEYTEARLQERENESQQFKERLTQDKEELDRQREAYQ
HDLERLRESQRAVEKEKDRIEHLKKLKKQNTVSGTLPPEGIEGHILSTSLNFNGEGLEGA
GHLAKTLGRTSTLLSGSDYVERPEMARRDSTTAEGRPVKNDVPIQLLSATNQIQKQAAVQ
QQIPTKLAVFTKGSKEKGGKGKGSQRSDSSTSFDLKQQLMLNKIMGKEENTIRNRRSLSP
VLTSQNVIIHPESCIPADIQPSEISHLNLGNMFRPNSTPILSPPAQLPVHLTSEEDANKE
DVIFF
Download sequence
Identical sequences F7CZN8
ENSMODP00000018921 XP_007489633.1.35504 XP_016287793.1.35504 XP_016287794.1.35504 ENSMODP00000018921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]