SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D0J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D0J3
Domain Number 1 Region: 97-294
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-29
Family Pleckstrin-homology domain (PH domain) 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7D0J3
Sequence length 297
Comment (tr|F7D0J3|F7D0J3_CALJA) SET binding factor 1 {ECO:0000313|Ensembl:ENSCJAP00000020688} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SBF1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MYAPEDTEVLRPYSNVSNLKVWEFYTEETLAEGPPYDWELAQGPPEPPEEERSDGGPPQS
RRRVVWPCYDSCPRTQPDAISRLLEELQRLETELGRPTERWKDTWDRVKAAQRLEGRPDG
RGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTASGSRQAARRSTSTL
YSQFQTAESENRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTDCKGVIDLA
EVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSAQQWVDRIQSCLSDA
Download sequence
Identical sequences F7D0J3
ENSCJAP00000020688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]