SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D1Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D1Q7
Domain Number 1 Region: 264-354
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-17
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 128-193
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000572
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7D1Q7
Sequence length 751
Comment (tr|F7D1Q7|F7D1Q7_MONDO) Ankyrin repeat and fibronectin type III domain containing 1 {ECO:0000313|Ensembl:ENSMODP00000018543} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ANKFN1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
QLLQKLKNYSRSLGCSVLIGRRFTCFAQRLSQRQKQNQCDLLNEDAGQLPTTSSASSKLN
WTSHVKMTQQMQNLHLSQTKKNSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRARTDR
LSLRKTSVNFQGNEAMFEAVEQQDMDAVQILLYQYSAEELDLNTPNSEGLTPLDIAIMTN
NVPIARLLLKTGARESPHFISLESRSAHLNTLVQEAQQRVNELSAQVENEGFSMDSTEKE
KQLKAWEWRYRLYKRMKTGFEHARPPEVPTNVCLMVTSNTSLTVTFQEPHSVNAAVVTKY
KVEWSISKDFSPLAGEIIMDNLQSLRCTITGLSKGQHYFVQVSAYNMKGWGPPQTTAPVC
ATPSNWKDYDGREPRHKGQNEALERLLQQIGAAHQRYSCRESSKLQNTGRKQSVSRSLKH
LFHSSNKFVKTLKRGLYIAVIFYYKDNMLVTNEDQIPIVEIDDSHSSSITQDFLWFTKLS
CMWEDIRWLRQTVPISMSSSTTLQARQKMLAATAQLQNLLGTHNLGRIYYEPIKDRHGNI
VIVTIREVETLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILIITIQDILSYQKRSQQ
RLPPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRDNNNVSKDEWEWIQKLSGSESM
ESIDHSCDCPTQLFFYELQMAVRALLKQINLPLPQARHFRLYTQEVLEMGHNVSFLLLLP
ASDDVCTAPGQNNPYTPHSGFLNLPLQMFEL
Download sequence
Identical sequences F7D1Q7
ENSMODP00000018543 ENSMODP00000018543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]