SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D345 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D345
Domain Number 1 Region: 224-350
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-30
Family SH2 domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7D345
Sequence length 353
Comment (tr|F7D345|F7D345_MONDO) Src homology 2 domain containing transforming protein D {ECO:0000313|Ensembl:ENSMODP00000032675} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SHD OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAKWLRDYLSFGGRRPPPQPPKPDYTESDIFRAYRVQKSLDFEDPYEDGDGQEEPESTCP
SCPNKPSCPGDPSYSSPKHRLIKVESGDLNRSKMLLGAPGEDKVNDSEYSDPFDAQPDAH
PWDSMSPFSKKNVLLNMEGSNLQLYDTPYEEQEVGGSPEAEERPRQSRLPRDDERPAEEY
DQPWEWKKDHISRAFAVQFETPEWERAPGLAKEFRRPPAKTSGWVGKGPDPEEHIPQPAE
RVDPALPLEKQPWFHGSLSRAEAENLLALCREGSYLVRQSETSHPDFSLSLRSSQGYMHM
KFTRTKENKFVLGQHSGVFSSVPEVVHHYSIRPLPVQGTEHLALLHPITAQVP
Download sequence
Identical sequences F7D345
13616.ENSMODP00000032675 ENSMODP00000032675 ENSMODP00000032675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]