SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D3T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D3T7
Domain Number 1 Region: 71-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.18e-28
Family Ankyrin repeat 0.00094
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-23
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7D3T7
Sequence length 214
Comment (tr|F7D3T7|F7D3T7_MACMU) Osteoclast-stimulating factor 1 {ECO:0000313|EMBL:AFE64673.1, ECO:0000313|Ensembl:ENSMMUP00000013637} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=OSTF1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNNEKKLAFDMA
TNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD
Download sequence
Identical sequences A0A096P1T3 A0A0D9R6J2 A0A2K5ERS5 A0A2K5JJB1 A0A2K5NXZ3 A0A2K5VI29 A0A2K6A0P6 A0A2K6DER3 A0A2K6KU24 A0A2K6QZX9 A0A2K6TQ47 F7D3T7 G1QMY2
ENSNLEP00000002298 ENSPANP00000019308 ENSMMUP00000013637 ENSNLEP00000002298 XP_003267475.1.23891 XP_003920902.1.74449 XP_005582006.1.63531 XP_007967716.1.81039 XP_010387025.1.97406 XP_011769251.1.29376 XP_011802407.1.43180 XP_011823634.1.47321 XP_011912132.1.92194 XP_012309666.1.9421 XP_014973399.1.72884 XP_017748214.1.44346 9544.ENSMMUP00000013637 ENSMMUP00000013636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]