SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D3V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D3V8
Domain Number 1 Region: 50-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000771
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 2 Region: 275-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000531
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7D3V8
Sequence length 419
Comment (tr|F7D3V8|F7D3V8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000032657} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100023968 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSLVHTPLLLLWAWGSFWAFEFVEKENIFQKTSCPAFLMFDNAAYLADMSFELPCHCKPE
EVSTVVWYYQKYIGSRHTRVLTDFDGRVVVDSGHIRVGSSMLARFSIQMFSLLVFRAQPE
DSGLYLCGTRQGNYFYGYDVDIQSSQNMLATFIDQGQKPPKDEKHGTLHIFTTFWEWTHC
DRCGVRGEQWRIGLCYLNKPGLSPRVRKTLPDVVSCGSQAVPKNIQNMAERHHPPELMIR
SCMVPCKKKKIQVGLMAIYTFISKKNRKPWIPKVPIQFHQQRLGHGLIISCPGARPEHAV
AWDKDNFRLYRTSFLKGVNWSMRVFIDHGNQLHIRFAQLNDRGIYYCWREGEMVAGFRLA
VTSWGPHHASLSDPETQYALKAALIGYLFLTAAFILIHLCRCCGDLFLLLLSIDFSLGP
Download sequence
Identical sequences F7D3V8
ENSMODP00000032657 XP_007482524.1.35504 ENSMODP00000032657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]