SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D4E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D4E6
Domain Number 1 Region: 5-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-44
Family Calponin-homology domain, CH-domain 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7D4E6
Sequence length 203
Comment (tr|F7D4E6|F7D4E6_XENTR) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=tagln2 OC=Silurana.
Sequence
TLLIKNMANKGPAYGLSREVQQKIDQKYDNDLETILVQWIKAQCGTHAGSFDGQGKSAVQ
VWLKDGTVLSHLINSLAPGSIAKVQTSAMAFKQMEQISQFLKACERYGIPASDLFQTVDL
WEGKDMASVQRTLMNLGGIAVTKGDGYFRGDPNWFPKKSQENKREFSQDKLKEGQNIIGL
QMGTNKGASQSGMTGYGMPRQIL
Download sequence
Identical sequences F7D4E6
ENSXETP00000056922 ENSXETP00000056922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]