SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7D5Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7D5Y6
Domain Number 1 Region: 23-67
Classification Level Classification E-value
Superfamily LysM domain 0.0000000314
Family LysM domain 0.0047
Further Details:      
 
Weak hits

Sequence:  F7D5Y6
Domain Number - Region: 405-447
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0484
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7D5Y6
Sequence length 824
Comment (tr|F7D5Y6|F7D5Y6_XENTR) Nuclear receptor coactivator 7 {ECO:0000313|Ensembl:ENSXETP00000056739} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=ncoa7 OC=Silurana.
Sequence
ENQNNKNVKKEKKMVTRRPLGTIEYTATGTDTLNSIALKFNLTPNKLVELNKLFTHTIVP
GQILYVPDSSVASIARDPKANAGILASPLSSDAEYDKLPDADLARKASKPIERVLSSTSE
EEEPADVKFIKMNCRYITDGKGVVGGVMIVTPNNVMFDPHKSDPLVIENGCEEYGLICPM
EEVVSVALYNDISHMKIKDALPSDIPKDLCPLYRPGEWEDLSSEKDINPFSKFKNLSKEK
RQQNGVSGQSIAENKLITTSSKDLDLIKITTELEPKNGSDGQLSPVQLTVDERLAIQTDQ
SIENITSSRTKKADNSPVEDDFIELVATTAEANCKNNYKESENHTVVGEAIEHSMFQNDI
PCNNSESNRTVDVICPVEQISDPVKRICLVSDKTETTSDSDFIQTLQQSKNIELCLSPAE
KNKLDICGFQRSDLDNSGDEGKVMSCINLEPKNITEVTTVTQNVENKLSKPEEKASEESV
DSLSPSSPEVPSQKETLMDSESELKLWLIKRMQRPIEDLFPSKEEKSKVPPMFLCIRVGK
PMRKSFASQSTAVVQQYIRRRKQPEYWFAVPQERVDHLYNFFVQWSPEVYGKDAKEQGFV
VVEKDELNMIDNFFSEPSTKSWEIITVEEAKRRKSTCSCYDDDEDEEETLEDFLPDLKQK
SVLLDDMQVEKLAHNLPARVQGYLWHLVYSTQEHGTSLKTLYRNLATVDSPVLLVVKDMD
NQQVFGAYATHPFRLSDHYYGTGETFLYTFCPDFKVYKWSGENSYFINGDISFLGLGGGG
GRFGLWLDSDLYHGRSNACCTFNNDTMSKKEDFIVQDIEVWAFE
Download sequence
Identical sequences F7D5Y6
ENSXETP00000056739 ENSXETP00000056739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]