SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DA37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DA37
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000312
Family LASP-1 0.017
Further Details:      
 
Weak hits

Sequence:  F7DA37
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0389
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DA37
Sequence length 1696
Comment (tr|F7DA37|F7DA37_MACMU) Nebulin related anchoring protein {ECO:0000313|Ensembl:ENSMMUP00000001624} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NRAP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNVQACSRCGYGVYPAEKISCIDQIWHKACFHCEVCKMMLSVNNFVSHQKKPYCHAHNPK
NNTFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQFKSVFHWDMKSKDKEGAPNRQPLANE
RAYWTGYREGNAWCPGALPDPEIVRMAEARKSLGEEYTEDYEQPRGKGSFPAMITPAYQR
AKQANQLASQVEYKRGHDERISRFSTVADTPELLRSKAVAQLQSDVRYTEDYEEQRGKGS
FPAMITPAYQIAKRANELASDVRYHQQYQKEMRGMAGPAVGAEGMLTRECADQYGQGYLE
EYEEHRGKGSFPAMITPAYQNAKKAHELASDIKYRQDFNKMKGAAHYHSLPAQDNLVLKR
AQSVNKLVSENKYKENYQNHMRGRYEGVGMDRRTLHAMKVGSLASNVAYKADYKHDIVDY
NYPATLTPSYQTTMKLVPLKDANYRQSIDKLKYSSVTDTPQIVQAKINAQQLSHVNYRAD
YEKNKLNYTLPQDVPQLVKAKTNAKLFSEVKYKEGWEKTKGKGFEMKLDAMSLLAAKASG
ELASNIKYKEEYEKTKGKATGTADSRLLHSLQIAKMSSEVEYKKGFEESKTRFHLPMDMV
NIRHAKKAQALASDLDYRKKLHEYTVLPEDMKTQWAKKAYGLQSELQYKADLAWMKGVGW
LTEGSLNLEQAKKAGQLVSEKNYRQRVDELKFTSVTNSSQMEHAKKSQELQSGVAYKAGN
EQSVHQYTISKDEPLFLRARANAANLSEKLYKSSWENQKAKGFELRLDSLTFLAAKAKRD
LASEVKYKEDYERSRGKLIGAKGVQGDSQMSHSLQMSKLQSELEYKKGFEDTKSQCHVSL
DMVHLVHARKAQHLATDIGYKTAAHHFTALPTDMKVEWAKKAYGLQSDNQYRADVKWMKG
TGWVATGSLNVEQAKKAGELISEKKYRQHPDALKFTSIKDTPEMVQARISYTQAVDRLYR
EQGENIKHHYTPTADLPEVLLAKLNAMNISETRYKESWSKLRDGGYKLRLDALPFQAAKA
SGEIISDYKYKEAFEKMKGQMLGSRSLEDDISLAHSVYATSLQSDVNYKKGFEHSKAQFH
LPLDMAALVHAKKAQTLASDQDYKHPLPQYTSLAEDLRLSCAKKAHKLQSENLYRSDLNF
MRGVACVIPGTLEIEGRKKASELISESKYRQHPHSFKYTAVTDTPNLLHAKFSNQITNER
LYKAAGEDARHQYTMTLGLPEFIRAKTNAANLSDAKYKESWHNLRAQGYKLTIEALPFQA
ARASGDIASDFLYRHDFVKERGKLIGPQSVSDDPRIQHCRRMGQLQSELQYRRGATSSQA
QFHLPMDMVHLVHARKAQALASNHDYRTQCHEFTALPEDLKMAWAKKAHALQSELRYKSD
LVGMKGIGWLALRSPQIESAKKAGELISETKYRKKPDSIKFTTVVDSPDLVHAKNSYIHC
NERMYRSGDAESLHRYTLIPDHPDFTRARLNALHLSDKVYRNSWEQTRAGSYDFRLDAIP
FQTARASREIASDFRYKEAFLRDRGLQIGYRSIDDDPRMKHFLNVGRLQSDNEYKKDFAK
SRSQFHSRTDQPGLLQAKRSQQLASDVHYRQPLPQPTCDPEQLGLRHAQKAHQLQSDVKY
KSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYHRRAEAVEAGDHQSGEVNP
DATEILHVKRKKALLL
Download sequence
Identical sequences F7DA37
ENSMMUP00000001624 XP_015003701.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]