SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DB99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DB99
Domain Number 1 Region: 524-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-127
Family Hect, E3 ligase catalytic domain 0.00000000436
Further Details:      
 
Domain Number 2 Region: 20-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-29
Family PLC-like (P variant) 0.093
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000278
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 183-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000264
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000515
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 418-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000153
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DB99
Sequence length 900
Comment (tr|F7DB99|F7DB99_CALJA) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NEDD4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MATCAVEVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTNGSEDDNAEQAEELEPGWVVLDQPDA
ACHMLQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGSIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPAHLAEE
LNARLTIFGNSATSQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSETEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTALDTSSDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRITGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHAKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQLFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences F7DB99
ENSCJAP00000003988 XP_002753544.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]