SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DDD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DDD9
Domain Number 1 Region: 227-391
Classification Level Classification E-value
Superfamily LigT-like 0.000000000000209
Family 2'-5' RNA ligase LigT 0.0069
Further Details:      
 
Weak hits

Sequence:  F7DDD9
Domain Number - Region: 19-39
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000424
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DDD9
Sequence length 393
Comment (tr|F7DDD9|F7DDD9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000030328} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
APAAKSPDGGMEEAGPPAPTCRFYQEGRCHFGARCRLPHPGAQAEPGPEPPSGPPRGKKA
PMRTARAVIDRILWDPQLDPDDFSVGYVDRFRGVLEEPFNAFCWDQDLAALGPGVLAVPQ
HRIRYFRHRGRLVWDRASRTDLVFGSAAGRWTTILDGATEAGETEPCGPGEEGAAEAGPQ
GEDGAPEPGPQGEAPTPTSSGESQGGSLDGSSLLEAEGECCPGLRPTHFVALPINDPGLR
QAVAKAQARLVAAEPSLGSSLVDPDALLLTLVLLRLTGPGEVAAAAGALRRLVRAPGFHP
PEELHFGGLACLDSRVIYSVPSPDLRGLARALARELEAQGLQVLERPGQALGPHLTLAKV
PFGSPACLFLPGAQEGAELGSQAAEGLALCSVG
Download sequence
Identical sequences F7DDD9
13616.ENSMODP00000030328 ENSMODP00000030328 ENSMODP00000030328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]