SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DDN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DDN8
Domain Number 1 Region: 189-254
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DDN8
Sequence length 333
Comment (tr|F7DDN8|F7DDN8_CALJA) TAL bHLH transcription factor 1, erythroid differentiation factor {ECO:0000313|Ensembl:ENSCJAP00000039525} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TAL1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTERPPSEAACSDPQLEGRDAAEARMAPPHLVLLNGVAKETSRAAPAEPPVIELGARGGP
GGGPAGGGGAARDLKGRDAAAAEARHRVPTTELCRPPGPAPAPAPASAPAELPGDGRMVQ
LSPPALAAPAAPGRALLYSLSQPLASLGSHSGFFGEPDAFPMFTTNNRVKRRPSPYEMEI
TDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINF
LAKLLNDQEEEGTQRAKPGKDPVVGAGGGGGGGGGSAPPDDLLQDVLSPNSSCGSSLDGA
ASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Download sequence
Identical sequences F7DDN8
ENSCJAP00000039525 ENSCJAP00000039525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]