SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DFD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DFD1
Domain Number 1 Region: 25-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000491
Family Eukaryotic type KH-domain (KH-domain type I) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DFD1
Sequence length 116
Comment (tr|F7DFD1|F7DFD1_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000041403} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LOC103793191 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGTLPERRNIPPWVKVPEDLKDPEVFHVQTRLLEAMFGRDGCRIPYIEQVSKAMLELKAL
ESPDCTEIVVYGSCIYKLRAKWMLQSMAEWHRQRQERGMLKLEEAMNALELSPWMK
Download sequence
Identical sequences F7DFD1
ENSCJAP00000041403 ENSCJAP00000041403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]