SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DJD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DJD1
Domain Number 1 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 326-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 567-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 430-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000822
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 233-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000735
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DJD1
Sequence length 626
Comment (tr|F7DJD1|F7DJD1_MACMU) Zinc finger protein 471 {ECO:0000313|Ensembl:ENSMMUP00000055384} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_11115 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKHLYRSMMLENYQSLVSLGLCISKP
CVISLLEQGREPWEMTSEMTRSPFSDWESIYETQELPLKQFMYDDACMEGITSYGLECST
FEENWKWEDLFEKQMGSHNIFSKKETITHKETLTKETEFKYTKFGKCIHLENIEENIYNH
TSDKKSFSKNSMVIKHKKVYVGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYECEECG
KAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFR
QPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTS
FIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCDVCGKTFSSGSSRTV
HQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRI
HTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGE
KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQ
CFECGKAFRRKLSLIYHQRGHTGEEP
Download sequence
Identical sequences A0A2K6CU82 F7DJD1 G7PZ21
9544.ENSMMUP00000004336 ENSMMUP00000004336 ENSMMUP00000004336 XP_002801502.1.72884 XP_005590516.1.63531 XP_011750212.1.29376 XP_011750218.1.29376 XP_011750219.1.29376 XP_011750220.1.29376 XP_011750221.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]