SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DL42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7DL42
Domain Number - Region: 62-148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DL42
Sequence length 309
Comment (tr|F7DL42|F7DL42_ORNAN) Centromere protein K {ECO:0000313|Ensembl:ENSOANP00000007483} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=CENPK OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
RSPCGFNSRPRPLVFALRPLPTSFFRLQAERLAKHMSVYQQDLAPDITTDASYAAEAKEA
LINECEELWKQMEECQNKLSSLGPETLTDSDAQLSLLIMRVKGLTAERNQWQKRTPEIVP
NNQDILSALGKEELQKLDQDLEMVLSAVQAQNVKLKEDLRREQQWLNEQEQLIESLKVTH
DELKTQEVHFSEERAVRELKSKMIKIKAYKEELLSALGEFLDNHFPLPEEDENVKKKKKK
KCAGPTVQLISLHEILEILISKLLTAPHEPYVAIQDSFWPPYIELLLRSGIALRHPEDPN
RIRLEAFHQ
Download sequence
Identical sequences F7DL42
ENSOANP00000007483 ENSOANP00000007483 9258.ENSOANP00000007483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]