SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DLZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DLZ3
Domain Number 1 Region: 220-289
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.2e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DLZ3
Sequence length 314
Comment (tr|F7DLZ3|F7DLZ3_CALJA) Transcription factor EC {ECO:0000313|Ensembl:ENSCJAP00000009516} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TFEC OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLEALTGLQFQLKEQLGEKERRLQHSQEISTQQTEFHMQFSYKPMFHRLVPARPQIYSSQ
LPSFTKVPAHLESSAQLQKAQREHVNSFMTLDHQIIPTLKRSQPAVPSGGPLVQHAHTAL
DSDAGITENPLTKLLTLGKEDDNAQWHMEDVIEDIIDMESSFKEEGTDSPLLMQRTLSGS
ILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRY
NINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQAN
RRLLLRIQVFIRML
Download sequence
Identical sequences F7DLZ3
ENSCJAP00000009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]