SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DQ32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DQ32
Domain Number 1 Region: 93-168
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000131
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 2 Region: 929-1018
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000471
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 3 Region: 848-919
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000902
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  F7DQ32
Domain Number - Region: 775-834
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00392
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 181-265
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00412
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 17-81
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DQ32
Sequence length 1187
Comment (tr|F7DQ32|F7DQ32_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000008764} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
IVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEP
PLGWSFEPTTVELHVDGVSDICTKGGDVNFVFTGFSVNGKVLSKGQPLGPAGVQVSLRST
GTDAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNANAASPLVV
AGYNVSGSVRSDGEPMKGVKFLLFSSSVAKEDVLGCNISPVPGFQPQDESLVYLCYAVSK
EDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSRLDFTVEHDSLKIEEHIFGEANWLVRR
VVTGGAGAGAPGTGRTVNHTDIVKTRLDHGIRGKEIQLGTNKVAARKEDVRTEMPPFRLQ
PRPPAGLNGPFHRFSVCGQIAILRFPDSAKQMSKYRVVLSSQEKDKALVNVEDAQGSFCF
KAKPGTYKVQVVVPEAETRAGLTLKPQTFPLEVTDRPVLNVAFVQFLASVSGKVSCLDSC
GDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFDNVLPGKYKISMMHEDWCWKNKSLEVEV
LEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYK
VTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALV
LGPLKSVQELRREQQLAEIESRRQEREKSGKEEAGAEGTKPPIQEMVDELQGPFSYDFSY
WARSGEKITVTPSSKELLFYPPSMEATVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVE
IVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVSSQKEGYVLTAVEGTVGDFKAYAL
AGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRF
EPSSQMIEVEEGQNLRIAITGYRTAYSCYGTVSSLNGEPEQGVAVEAVGQSDCSIYGEDT
VTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIAVGNNDIDDVNIIVFRQIN
QFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSVFFHFPPLLRDGQNYVVLLD
STLPRSQYEYVLPQVSFTALGYHKHITLVFSPTRKLPEQDVAQGSYIALPLTLLVLLAGY
NHDKLIPLLLQLTSRLQGVRGLGQTASDSSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences F7DQ32
ENSECAP00000008764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]