SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DSW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DSW8
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-57
Family Protein kinases, catalytic subunit 0.0000000768
Further Details:      
 
Domain Number 2 Region: 15-196
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.21e-39
Family Ephrin receptor ligand binding domain 0.0000177
Further Details:      
 
Domain Number 3 Region: 335-539
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-35
Family Fibronectin type III 0.0000639
Further Details:      
 
Domain Number 4 Region: 903-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.48e-17
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Weak hits

Sequence:  F7DSW8
Domain Number - Region: 284-338,374-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DSW8
Sequence length 978
Comment (tr|F7DSW8|F7DSW8_ORNAN) EPH receptor B6 {ECO:0000313|Ensembl:ENSOANP00000019829} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=EPHB6 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
LWGMEHAFLIFSCLEMLLDTTGVTSEIGWLTYPPGSWDEVSVLDDQRRPARTFEACHVAG
PGGEQDNWLRTHFVERRGAQRAHVRLLFSVRACASLGAGGRPAGGPTCRETFTLYYRQAD
GDGPTGPAWHRGPWTKVDTIAADESFPAPPPLATGSVGAVGAWAGSWRRPGLAEHQGTCF
GPLSQRGFYLDLPGHGRYSQTVEVRPAPSPEPVILLQLAPSVSLQAELGAGHSVGWRETE
MLQRAVVGRGGRTTGSPSREGPGRAWAAGMPVGSEPLPCISTACPVGSFKAAAGDTPCTP
CPPRSQAPEPGTPICPCLSGFFRPISDPPDAPCTGPPSAPQDLRFEIQGSAVLLHWRLPL
DLGGRGDVVFNVVCKECEGAACRRCGDGVRFDPRQRGLSESRVLVAGLRPHVPYTLEVQA
VNGVSELSPDPPQATPVNVTTSHAVPSAVPVVHQVSRAADSITVSWPQPDQPNGLILDYQ
LRYCDQADDEASSSTLTSETNVATVAQLSPGHVYAFQVRARSAAGHGPYGGKAYFQTLPR
GELSHLAPERLPLVVGSALGALAFLALAAVAILTLVFKRKRRPSVYSERLQHRISSRGEX
SEWTCRRSPPRDPTPRLDLSPAPPPPWPPLTPRLHTGSFGEVCRGRLQPVGRREQAVAIQ
TLRAGWTEGQRRAFLARASLLAQFQHPNILRLEAVVTKSRPLMVLTELMEHGPLDSFLRQ
REGQFSVLQLVSMQRGVAAALLYLSGRGFVHRALAAHSVLVNGHLVCKVARLGHGPDGRP
SPRWAAPEVVSHGKFTSASDVWSFGVIMWEVMSYGERPYWDMSDQEVLTAVGQEFRLPPP
PGCPAPLHLLMLDTWHRERVQRPRFDQLVAALDKMIRKPDGLKASVDPGDRPSQPLLSPS
APDFPSLETPQAWLQAIGMERYQDNFAQAGLGRFEDVARLKLEDLQALGITLAGHQKKLL
HSVHLLQLYLSRPGSVEV
Download sequence
Identical sequences F7DSW8
ENSOANP00000019829 9258.ENSOANP00000019829 ENSOANP00000019829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]