SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DT19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DT19
Domain Number 1 Region: 1170-1287
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-28
Family Plakin repeat 0.00000159
Further Details:      
 
Domain Number 2 Region: 839-967,994-1021
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 329-458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000425
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 4 Region: 192-275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000489
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DT19
Sequence length 1354
Comment (tr|F7DT19|F7DT19_CALJA) Desmoplakin {ECO:0000313|Ensembl:ENSCJAP00000039718} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=DSP OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSCNGGSHPRINTLGRLTRAESGPDLRYEVTCGGGGGGGTSRMYYSRRGVITDQNPDGYC
QTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDEYFAQANDQ
MEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSG
SGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRSIHNAIGDYRWQLDK
IKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYD
WSDRNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQ
WSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQ
IKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVH
KGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALW
NQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGS
EMFGDDDKRKMQSQFTDAQKHYQTLVIQLPGHPHHQTVTTTEITHVGTCQDVNHNKVIET
NRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQ
AIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAI
LQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQ
IHSQTSQQYPLYDLDLGKFSEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQA
FCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANS
IKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADVHARYIELLTRSGDYYRFL
SEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLT
SLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKN
DYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGARKKMSAAEAVKEKW
LPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTNSYAKILTCP
KTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGS
RSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH
Download sequence
Identical sequences F7DT19
ENSCJAP00000039718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]