SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DTC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DTC3
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 467-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 625-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 429-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 508-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000175
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-256
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000889
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 370-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000758
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DTC3
Sequence length 679
Comment (tr|F7DTC3|F7DTC3_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000023624} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=TIGD7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASGPSPQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRETEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLVSHSQVRRSQAPRWGQGERLWDPSVQSCKEGAAPGEEKFENLEE
GVPSVSSENTHPQVLLPDQARGEVPWSPELGRPRDRQQGDWAPPPEGGMEQALAGASSGR
ELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCSEIFGGNPRFLSL
HRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRHQRTH
TGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTHERER
LYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGEKPYK
CTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSEC
GESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F7DTC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]