SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DTI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DTI3
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-19
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 285-338,503-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000698
Family Second domain of FERM 0.0045
Further Details:      
 
Weak hits

Sequence:  F7DTI3
Domain Number - Region: 17-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00056
Family Ubiquitin-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DTI3
Sequence length 677
Comment (tr|F7DTI3|F7DTI3_HORSE) Fermitin family member 1 {ECO:0000313|Ensembl:ENSECAP00000000246} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FERMT1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLSSSDFASASWELVVRVDHPNEEEQKDITLRVSGDLHVGGVMLKLVEQINISQDWSDFA
LWWEQKRCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNVKTVRLRVSFSAVVFKA
VSDICRALNIRRSEELSLLKPSSDYFKKKKKKDKNNKEPIIEDILNLECSPTISGSPVSP
GLYSKTMTPTYDPVNGTPASSTMTWFSDSPLTEQNCSILAFSQPPQSPEALADMYQPRSL
VDKAKLNAGWLDSSRSLMEQGIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHISKLSLSAEIQDFTNESEVDEVEAALSNLEVTLEGGKVD
SALEDITDIPKLADNLKLFRPKKLVLKAFKQYWFVFKDTSIAYFKNKELEQGEPVEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDHENQYAQWMAACILASKGKTMADS
SYQPEVLNILSFLRMKNRNLASPVASNLENMDVNPECFVSPRCAKKHKSKQLAARILEAH
QNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIP
ITTWRFTNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQE
Download sequence
Identical sequences F7DTI3
ENSECAP00000000246 9796.ENSECAP00000000246 XP_001493999.1.31192 XP_008536214.1.77740 ENSECAP00000000246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]