SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DVT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DVT3
Domain Number 1 Region: 273-424
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000989
Further Details:      
 
Domain Number 2 Region: 427-584
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.54e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000906
Further Details:      
 
Domain Number 3 Region: 645-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-35
Family MAM domain 0.0014
Further Details:      
 
Domain Number 4 Region: 145-262
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00000129
Further Details:      
 
Domain Number 5 Region: 35-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-32
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DVT3
Sequence length 922
Comment (tr|F7DVT3|F7DVT3_MONDO) Neuropilin {ECO:0000256|PIRNR:PIRNR036960} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NRP1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MDWGLLLLHCAALTVAVSSAVRNGKCGDNIKIVSPGYLTSPGYPHSYHPSEKCEWLIQAP
DPYQRIMINFNPHFDLEDRDCKYDYVEVIDGDNANGRLWGKYCGKIAPPPVVSTGPFLFI
KFVSDYETHGAGFSIRYEIFKRGPECSRNYTSSTGVIKSPGFPEKYPNSLECTYIIFAPK
MSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGLPDVGPHIGRYCGQKTPGRIRSSTG
ILSLAFYTDSAIAKEGFSANYSVLQSSVSEDFTCMEPLGMESGEIHSDQITVSSQYSTNW
SAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVSAIGTQGAISKETKKEYYVKTYRVD
ISSNGEDWITIKEGNKPTIFQGNTNPTDVVYGVFPKPFITRFIRIKPVTWETGISMRFEV
YGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRSGWALPSAPHSYT
NEWLQIDLGEEKIVKGIIIQGGKHRDNKVFMKKFKIGYSNNGSDWKMIMDESKRKTKSFE
GNNNYDTPELRTFTPLTTRFIRIYPERATHGGLGLRMELLGCEVEVPTAGPTTPNGNPVD
ECDDDQANCHSGTGDDFQLTGGTTILTTEKPTVIDSTMQSEFTAYGFNCGFGWGSHKTFC
QWEHDNQVELKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLLSPVVYSQNSAHC
MTFWYHMSGSHVGTLRVKLRYQKPDEYDQTLWTAIGHQGNHWKEGRVLLHKSLKHYQVIV
EGEIGKGNLGGIAVDDISINNHISQEDCKKSTDLDNKDKENSNAGTGSTLGYEGMGEGDE
NISRKPGNVLKTLDPILITIIAMSALGVLLGAICGVVLYCACWHNGMSERNLSALENYNF
ELVDGVKLKKDKLNTQNTYSEA
Download sequence
Identical sequences F7DVT3
ENSMODP00000009242 ENSMODP00000009242 XP_001366507.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]