SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DX65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DX65
Domain Number 1 Region: 277-347
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000204
Further Details:      
 
Domain Number 2 Region: 9-84
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000191
Further Details:      
 
Domain Number 3 Region: 95-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.04e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DX65
Sequence length 349
Comment (tr|F7DX65|F7DX65_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000041146} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LOC100415053 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRKSTGAQVQVAGDMLPNSTEQAITIAGMPQSVTECVKQICLVMLETISQSPQGRVMT
IPYQPMPASSPVICAGGQDRYSNTAGYPHATHDLEGPPLDAYSIQGQHTISPLHLANLNQ
VARQQSHFAMMHGGTGFAGIDSNSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGT
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINAKLSS
Download sequence
Identical sequences F7DX65
ENSCJAP00000041146 ENSCJAP00000041146 XP_003732080.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]