SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DXC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DXC4
Domain Number 1 Region: 213-374,412-474
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-28
Family cAMP-binding domain 0.0081
Further Details:      
 
Domain Number 3 Region: 37-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.34e-17
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DXC4
Sequence length 611
Comment (tr|F7DXC4|F7DXC4_MACMU) Potassium voltage-gated channel subfamily H member 5 {ECO:0000313|Ensembl:ENSMMUP00000030959} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=KCNH5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVA
HWLACIWYSIGDYEVIDEVTNTIQMDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYV
SSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANTNR
YHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICVHL
NRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVIQD
DEVVAILDHLS
Download sequence
Identical sequences A0A096NVJ7 A0A2K6A9G5 F7DXC4
ENSMMUP00000030957 XP_011833667.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]