SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DXF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DXF2
Domain Number 1 Region: 176-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 87-154
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 529-578
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000552
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DXF2
Sequence length 583
Comment (tr|F7DXF2|F7DXF2_MONDO) Mex-3 RNA binding family member B {ECO:0000313|Ensembl:ENSMODP00000035382} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=MEX3B OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPSSLFADLERNGSGGGGGGGSGGGGGGGGGGGGGGGGGGGGGETLDDQRALQIALDQLS
LLGLDNDETGSLYDNEPRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKT
PVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGTVPGPPNLPGQTT
IQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIE
AHIALRTGGIIELTDENDFHANGTDVGFDLHHGGGGPGPGSLWSKPTPSITPTPGRKPFS
SYRNDSSSSLGSASTDSYFGGGTGGSTSAAATPRLTDYSPPSPALSFAHNGNNNNGNGYV
YPGGEATPSPDCCAELPGFDPAPAPPPGAQLLWSQFERSPGGGPAAPVSSSCSSSSASSS
ASSSSVVFPGGGGASPNANLGLLVHRRLHPGVSCPRLSPPLHGVGGEHHLARRVRSDPGG
GGLGYPAYANGLGAHLPGLPPSDSSASSSSSSSSSSSSSSSSGLRRKGSRDCSICFESEV
IAALVPCGHNLFCMECANRICEKSEPECPVCHTAVTQAIRIFS
Download sequence
Identical sequences F7DXF2
XP_007479330.1.35504 ENSMODP00000035382 ENSMODP00000035382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]