SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DXT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DXT9
Domain Number 1 Region: 194-405
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-53
Family DBL homology domain (DH-domain) 0.0000858
Further Details:      
 
Domain Number 2 Region: 422-538
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DXT9
Sequence length 634
Comment (tr|F7DXT9|F7DXT9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000035366} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NET1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
CSSRLQGASPPPTPLRLSPFASSPSSTAMEVEPVAATESAAQESEQPPPRRRGRRSRMSG
AAADTEAGLDVPASGPDHQRRYSLRRGSSFTFLTPGPHWDFTLKRKRREKDDDVVSLSSL
DLKEPSNKRVRSLARVSSLANLISPVRNGAVKRFECKLRSFTLRGDNRSPACAQKSFNRA
TVPTPSKRRNSVRWSEMLDINMKESLTTKEIKRQEAIYEMLRGEQDLIEDLKLARKAYHD
PMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARLGEATKPDGTVEQIGHILVNWLPGLNA
YRGYCSNQLAAKALLDQKKQDARVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLL
KEILRHTPKDHTDIKPLEEALLVIQGVLSDINLKKGESECQYYIDKLEYLDDKQKDPRIE
ASKVLLCHGELKNKNGHKLYIFLFQDILVLTRPVIRNERHSYQVYRQPIPVKELVLEDLQ
DGDVRMGGSFRGAFSNSDKAKNIFRVRFRDPSPGQSHTLQANDVFHKQQWFNCIRTAIAP
FHQTTSPTEFKGLSELNKGSEKNNPLASHIKSQRKSSTLSGLIPLEVDENSPECIPSIAI
NENSTDIKAHRIQPGSPKAQEKAQLNDKRKETLV
Download sequence
Identical sequences F7DXT9
ENSMODP00000035366 13616.ENSMODP00000035366 ENSMODP00000035366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]