SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DYB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DYB1
Domain Number 1 Region: 17-414
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-116
Family Amylase, catalytic domain 0.000000000000789
Further Details:      
 
Domain Number 2 Region: 420-510
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.03e-35
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DYB1
Sequence length 511
Comment (tr|F7DYB1|F7DYB1_HORSE) Alpha-amylase {ECO:0000256|RuleBase:RU361134, ECO:0000256|SAAS:SAAS00280836} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LOC100049851 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MKFLLLLSAIGFCWAQYDPHTQSGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENIVVNNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVVNHMCGS
GGGAGTSSTCGSYYNAGSRDFPAVPYSGWDFNDGKCNSGSGEVENYNDIYQVRDCRVVGL
LDLALEKDYVRSTIADYLNHLIDLGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTNWFPQG
SKPFIYQEVIDLGTEPIKGSEYFGNGRVTEFKYGAKLGTVLRRWDGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRIMSSYRWA
RNFQNGQDANDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQA
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPGGTYCDVISGDKVDGNCTGI
KIYVSSDGSAYFSISNTAEDPFIAIHAESKL
Download sequence
Identical sequences F7DYB1
ENSECAP00000017078 XP_001487909.1.31192 9796.ENSECAP00000017078 ENSECAP00000017078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]