SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7DYB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DYB8
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-22
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.68e-20
Family Platelet-derived growth factor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7DYB8
Sequence length 345
Comment (tr|F7DYB8|F7DYB8_HORSE) Platelet derived growth factor C {ECO:0000313|Ensembl:ENSECAP00000017076} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PDGFC OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSALPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKNGVRGLHKSLTDVALEHHEECDCVCRGNSGG
Download sequence
Identical sequences F7DYB8
ENSECAP00000017076 9796.ENSECAP00000017076 ENSECAP00000017076 XP_001500695.1.31192 XP_008512664.1.77740 XP_014699555.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]