SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E006 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7E006
Domain Number - Region: 43-130
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00157
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7E006
Sequence length 174
Comment (tr|F7E006|F7E006_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000002006} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MNRQWNILQAREQDKTPEKGLNETEIIDLLKKEFKQNIMRMLTDMGRRMDEHREHISKEL
EDIKRNQSEMKNTILEMRNSLEGLNSRVEEGEERISELDERLEEITQAEQKKGKRVRQNE
NSVREYWDNIKCANIRITGVPEGEERDKGAENLFEEIIDENFPNLRKETDIQVQ
Download sequence
Identical sequences F7E006
ENSECAP00000002006 9796.ENSECAP00000002006 ENSECAP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]