SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E0Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E0Z9
Domain Number 1 Region: 51-168
Classification Level Classification E-value
Superfamily C-type lectin-like 1.71e-29
Family C-type lectin domain 0.00000426
Further Details:      
 
Domain Number 2 Region: 264-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 209-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 171-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E0Z9
Sequence length 373
Comment (tr|F7E0Z9|F7E0Z9_HORSE) L-selectin {ECO:0000256|PIRNR:PIRNR002421} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SELL OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SYRRTREGPGRAMIFPWKCQRAQRGLWNVFKLWVWTVLCCDFFTHHGTNCWTYHYSEKPM
NWSGARKFCQENYTDLVAIQNKGEIEYLNEVLPFNRNYYWIGIRKVGTTWTWVGTNKPLT
EEAENWGDGEPNNKKSKEDCVEIYIKRFRDAGKWNDDACHKNKTALCYTASCKPWSCSGH
GECVETINNNTCTCDVGYYGPQCQFVIQCEPLQAPELGTMACVHPLGNFSFSSQCVFNCS
EGREIVGIEETTCGPSGKWSSPEPTCQVIQCEPLTAPDLGTMDCSHPLADFSFTSTCTFN
CSEGTELIGERKTICGSSGIWSSTSPMCQKLDRSFTAIKEGDYNPLFIPVAVMVTALSGL
AFIIWLARRLKKG
Download sequence
Identical sequences F7E0Z9
9796.ENSECAP00000017664 ENSECAP00000017664 ENSECAP00000017664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]