SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E1J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E1J0
Domain Number 1 Region: 120-262
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 17-122
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-33
Family Second domain of FERM 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7E1J0
Sequence length 425
Comment (tr|F7E1J0|F7E1J0_HORSE) FERM domain containing 5 {ECO:0000313|Ensembl:ENSECAP00000017361} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=FRMD5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
QHWLEFTKSVVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQA
EIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLE
TYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQK
EEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRV
AKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESL
RDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELM
LLSRQINGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHSRPEEEQAMVCLQNPLS
GEPAH
Download sequence
Identical sequences F7E1J0
ENSECAP00000017361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]