SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E239 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E239
Domain Number 1 Region: 217-336
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 8-92
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000000017
Family DBL homology domain (DH-domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7E239
Sequence length 408
Comment (tr|F7E239|F7E239_MONDO) Rho guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSMODP00000015465} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARHGEF3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKTSWNSFFFQAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLI
PLHEDLLSQLREVRKTDGSTEHVGPILVGWLVCVSVTDQGVSGNIDPGSKQIHRHRDSRK
TDSVQGLRQAPNLSLLPSIPLFRADEVLAELRCRLLPRGHSPREQPPGHSDCGHASRDPI
NIIQGIVAEINTKTGESECRYYKERLLYLEEGHKDCLIDSSRVLCCHGELKNNRGVKLHV
FLFQEVLVITRPVTHNEQLCYQLYRQPIPVKELLLDDLQDGEVRLGGSIRGAFTNTERIK
NFFRVSFRNGSQSQSHALQASDTFNKQQWLNCIRQAKETAVCAEGQAGLLGPREPSPPAA
PLAGEARPEQMDQSGSESDCSMDTSEVSLDCERMDSSGGSGKQVESNV
Download sequence
Identical sequences F7E239
ENSMODP00000015465 ENSMODP00000015465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]