SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E2H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E2H5
Domain Number 1 Region: 54-518
Classification Level Classification E-value
Superfamily Sema domain 1.83e-156
Family Sema domain 0.0000000861
Further Details:      
 
Domain Number 2 Region: 514-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000645
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E2H5
Sequence length 631
Comment (tr|F7E2H5|F7E2H5_HORSE) Semaphorin 6A {ECO:0000313|Ensembl:ENSECAP00000005073} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SEMA6A OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHKLDIQM
IMIMNRTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDTLFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIHINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNPEKCSYD
GVEDKRIMGMQLDKASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVKEGG
SCAHLSPGSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLWPSTTTSDSAAQEGYESR
GGMLDWKDLLDSPDSTDSLGAVSSHNHQDKK
Download sequence
Identical sequences F7E2H5
9796.ENSECAP00000005073 ENSECAP00000005073 ENSECAP00000005073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]